PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.1G021500.1.p
Common NameSETIT_016955mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family G2-like
Protein Properties Length: 514aa    MW: 56792.9 Da    PI: 6.2664
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.1G021500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.91.7e-31125178255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         prlrWtp+LH +Fv+ave+LGG+e+AtPk +l++m+v gL+++hvkSHLQ+YR+
  Seita.1G021500.1.p 125 PRLRWTPDLHMAFVHAVERLGGQERATPKLVLQMMNVRGLSIAHVKSHLQMYRS 178
                         8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.601121181IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.9E-29121179IPR009057Homeodomain-like
SuperFamilySSF466895.02E-14124179IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-22125180IPR006447Myb domain, plants
PfamPF002498.8E-9126177IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 514 aa     Download sequence    Send to blast
MVEQYKMVAR EEQVMKEIKD KGVLVEILED DEERSIDNKL LDLNEGLDVE SEEGEVGDDE  60
EDEGEEGDEG GSTIDVGGSG SSSNNSSTNN NSESKKGDTK GGSKSEGSGE QRVPTVRQYN  120
RSKLPRLRWT PDLHMAFVHA VERLGGQERA TPKLVLQMMN VRGLSIAHVK SHLQMYRSKK  180
LDQDGRPRGA ISSVYSPVDF HFMRGDRRFQ EMSFFQRAAV LSSSKLEHGS FFASRNCSAP  240
ELSRLYGLLQ HRPTPQTFDF RNSRNHEWAS SHREAMISRK DVTPPSTAPH QTHPLAGSAL  300
LRSERRWWPF TDAGAAAATG ERRAETGREA DFANSIGSSS RPHLCATAVS GDPRLPFRWR  360
PAGGSGRDVV GYPGNNAKIT TRSSDPVVID EALDPQQLER QRDSAMPAYN DEACRKRSLP  420
AETQDETSDL QLSLSPTTVM EAKKRKTTAL SGEQEIMDTR ELSISLSLSP PAAASMQKRQ  480
QEKTRRSNDS RSSGEAVLGQ STLDLTMSIR ALE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5406077e-73JX540607.1 Paspalum vaginatum clone StvCtg_09077 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004951340.10.0PREDICTED: uncharacterized protein LOC101755438
TrEMBLK3YRR10.0K3YRR1_SETIT; Uncharacterized protein
STRINGSi016955m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27543686
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.11e-33G2-like family protein